PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_1623_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HD-ZIP
Protein Properties Length: 238aa    MW: 27699 Da    PI: 4.6642
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_1623_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox597.8e-192983256
                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                   +++++f++eq++ Le +Fe++  +  +++ +LA++lgL+ rqV +WFqN+Ra++k
  Neem_1623_f_1 29 KNKRRFSDEQIRSLELMFENETRLEPRKKLQLARELGLQPRQVAIWFQNKRARWK 83
                   56779*************************************************9 PP

2HD-ZIP_I/II119.41.8e-3830121293
    HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                    +krr+s+eq+++LE +Fe+e++Lep++K +lareLglqprqva+WFqn+RAR+k+kqlE+dy+ L+++y++l+++ e+L+ke+++L  +l++
  Neem_1623_f_1  30 NKRRFSDEQIRSLELMFENETRLEPRKKLQLARELGLQPRQVAIWFQNKRARWKSKQLERDYSILQANYNNLASRFEALKKEKQALVIQLQK 121
                    79************************************************************************************999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.39E-191087IPR009057Homeodomain-like
PROSITE profilePS5007117.752585IPR001356Homeobox domain
SMARTSM003891.8E-162789IPR001356Homeobox domain
PfamPF000463.3E-162983IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.5E-193092IPR009057Homeodomain-like
CDDcd000865.00E-143486No hitNo description
PRINTSPR000319.6E-65665IPR000047Helix-turn-helix motif
PROSITE patternPS0002706083IPR017970Homeobox, conserved site
PRINTSPR000319.6E-66581IPR000047Helix-turn-helix motif
PfamPF021831.0E-1585127IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MLDGGEYTPA AEPFTCMNDL TTPRKKKCKN KRRFSDEQIR SLELMFENET RLEPRKKLQL  60
ARELGLQPRQ VAIWFQNKRA RWKSKQLERD YSILQANYNN LASRFEALKK EKQALVIQLQ  120
KMNDLLQNKP REQSQCCGQR EAVNSIDSEL DNGDTAKCES EVKPSLSLDR SEQRLGVLSD  180
DDSSIKAEYF GLEEEPNLMT MVEPAESSMT SPEDWGNFES DGLFDQSSSE YQWWDFWS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00320DAPTransfer from AT2G46680Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006444770.11e-136hypothetical protein CICLE_v10021877mg
RefseqXP_006491341.11e-136PREDICTED: homeobox-leucine zipper protein ATHB-7
SwissprotP468971e-82ATHB7_ARATH; Homeobox-leucine zipper protein ATHB-7
TrEMBLA0A067HEZ91e-136A0A067HEZ9_CITSI; Uncharacterized protein
TrEMBLV4U1T11e-136V4U1T1_9R
STRINGPOPTR_0014s09860.11e-123(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24982874
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.17e-84homeobox 7